Scaffold none_p243245

Overview

Basic Information

• Taxon OID: 2236876008
• Scaffold ID: none_p243245
• Source Dataset Name: Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-3LG-Deep1200
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 574
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Cape Meares
• Coordinates
  • Lat. (^o): 45.483
  • Long. (^o): -124.918
  • Depth (m): 1200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028194	Metagenome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
none_2432451	F028194	N/A	RKKELRKQYDDLLEKINKGKEAIRSMETSLIILQGAIQQCDWTLNQYKEKKDK