| Basic Information | |
|---|---|
| Taxon OID | 2236876007 Open in IMG/M |
| Scaffold ID | none_p0140480 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-0p1-Deep1200 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of South Carolina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 532 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cape Meares | |||||||
| Coordinates | Lat. (o) | 45.483 | Long. (o) | -124.918 | Alt. (m) | Depth (m) | 1200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005071 | Metagenome | 413 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| none_01404802 | F005071 | AGG | MSRLNTKEKCTLRDLIKIEIKSLSKIGYGKYKYFEDEYCAFLLKLGRKLKLDIQQKIKAKKVYR |
| ⦗Top⦘ |