| Basic Information | |
|---|---|
| Taxon OID | 2236876005 Open in IMG/M |
| Scaffold ID | none_p066727 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of South Carolina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 503 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River estuary, South channel near Astoria | |||||||
| Coordinates | Lat. (o) | 46.249 | Long. (o) | -123.986 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018169 | Metagenome / Metatranscriptome | 236 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| none_0667271 | F018169 | N/A | MDTNVDPALRHLAALHENKGLAIKLHFEKLAEQLGLKLIWSFDYIANYVPMISVCVSNDVNIIADQSLKFDRVCAWRKNKITNRTNTITRAVTVKRDLSAVYVDVKAKMNDDSVCAKHNVSVNTLAAVKAWITMGK |
| ⦗Top⦘ |