Scaffold none_p162635

Overview

Basic Information

• Taxon OID: 2236876001
• Scaffold ID: none_p162635
• Source Dataset Name: Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmax
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 519
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Columbia River Transect 7 km from mouth (CR7)
• Coordinates
  • Lat. (^o): 46.167
  • Long. (^o): -124.158
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048320	Metagenome	148	N

Sequences

Protein ID	Family	RBS	Sequence
none_1626352	F048320	N/A	MKTLLATLLLILCYACGSIKGQAYIDINENIDYEANEDLRYRTRFKVGYKIYLGEKHTIKQK