NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2226407811

Scaffold 2226407811


Overview

Basic Information
Taxon OID2225789001 Open in IMG/M
Scaffold ID2226407811 Open in IMG/M
Source Dataset NameSaline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11638
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)510
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake

Source Dataset Sampling Location
Location NameQinghai Lake, Tibetan Plateau
CoordinatesLat. (o)36.381Long. (o)100.218Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065363Metagenome127N

Sequences

Protein IDFamilyRBSSequence
2226611418F065363N/AEPVTIAAAIATAKVVAAGVGALSTVLRNVQGTAARNRITQLYNNNEYNVQNLNRLNARQVADQITRIDNAITLTPRTSFGQKMALSRFRLVYQQRFDQVSGGGGIGNLPGWVLPAALGLGAFLIFRGRK*TRYY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.