Scaffold 2225762366

Overview

Basic Information

• Taxon OID: 2222084011
• Scaffold ID: 2225762366
• Source Dataset Name: Coastal lagoon microbial communities from Albufera, Spain - Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University Miguel Hernandez
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1567
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain

Source Dataset Sampling Location

• Location Name: Spain: La Albufera de Valencia
• Coordinates
  • Lat. (^o): 39.330917
  • Long. (^o): -0.343
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046907	Metagenome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
2225180045	F046907	N/A	MPQDGVEVLITDVEGMQIVAHYSLRADLWFSENHSWFTSEVNYWMPIPEIV