NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2225762062

Scaffold 2225762062


Overview

Basic Information
Taxon OID2222084011 Open in IMG/M
Scaffold ID2225762062 Open in IMG/M
Source Dataset NameCoastal lagoon microbial communities from Albufera, Spain - Sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity Miguel Hernandez
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3252
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain

Source Dataset Sampling Location
Location NameSpain: La Albufera de Valencia
CoordinatesLat. (o)39.330917Long. (o)-0.343Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000847Metagenome / Metatranscriptome861N

Sequences

Protein IDFamilyRBSSequence
2225178802F000847N/AVNSFGTGDPLAIGTDNTINLRTPSRERIVYPLVFADVQSASTDLGSLALTVGVYFSDRVESIATMGGVVSGSPTLGWQDNEDEVLSDQLQIAQDFISALTNDPTQEWTLSTSVSLTRFVESRDDRTAGWVATLQFQIPYSHSVCEIPS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.