Basic Information | |
---|---|
Taxon OID | 2222084010 Open in IMG/M |
Scaffold ID | 2225745596 Open in IMG/M |
Source Dataset Name | Coastal lagoon microbial communities from Mar Menor, Spain - Sample 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University Miguel Hernandez |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1115 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mar Menor, Spain | |||||||
Coordinates | Lat. (o) | 37.72955 | Long. (o) | -0.7741 | Alt. (m) | Depth (m) | 4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089551 | Metagenome / Metatranscriptome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2225140914 | F089551 | GGAG | MPYNSKNAKPAYYKQNVTTFVQLFNNIVRLQYDTRISGSTAAQYIENMFNSYLQHSQNLQQAHNS |
⦗Top⦘ |