| Basic Information | |
|---|---|
| Taxon OID | 2222084010 Open in IMG/M |
| Scaffold ID | 2225744883 Open in IMG/M |
| Source Dataset Name | Coastal lagoon microbial communities from Mar Menor, Spain - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University Miguel Hernandez |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 781 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mar Menor, Spain | |||||||
| Coordinates | Lat. (o) | 37.72955 | Long. (o) | -0.7741 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005467 | Metagenome / Metatranscriptome | 400 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2225139422 | F005467 | AGCAG | MCQRGTLIHRAYVRMDPASADVLHDSLCERYDLVQVCDVPFSGVDPDLLITP |
| ⦗Top⦘ |