Scaffold 2225744200

Overview

Basic Information

• Taxon OID: 2222084010
• Scaffold ID: 2225744200
• Source Dataset Name: Coastal lagoon microbial communities from Mar Menor, Spain - Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University Miguel Hernandez
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1264
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain

Source Dataset Sampling Location

• Location Name: Mar Menor, Spain
• Coordinates
  • Lat. (^o): 37.72955
  • Long. (^o): -0.7741
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089551	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
2225137402	F089551	AGGAG	MPYNSKNAKPXYYKQNVTTFVQLFNNIIRLQXDSRISGSTAAQYIENMFNSYLQHSQNLQQHITPSVKRIKHKHWQ