NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2223609432

Scaffold 2223609432


Overview

Basic Information
Taxon OID2222084006 Open in IMG/M
Scaffold ID2223609432 Open in IMG/M
Source Dataset NameMarine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - oil_dispersant_7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAlabama State University
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)532
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Blowout, Alabama, Usa

Source Dataset Sampling Location
Location NameDaulphin Laboratory, Alabama, USA
CoordinatesLat. (o)30.15Long. (o)-88.446Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093740Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
2224064065F093740N/ASEIARYFDVRPSSIRSKLLSLAKRDPAYSQAIGRKNETLTDESASLHMRIDSYTLKMFSDAGNVLKRLQTTPIPDDIPSMIQRSDLQLKGLQIIEKVQKILGMGNQDTPRTLNVTHISNVLATPSTKDQDTQVLEG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.