| Basic Information | |
|---|---|
| Taxon OID | 2222084003 Open in IMG/M |
| Scaffold ID | 2222353468 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Ctl_5_microcosm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Alabama State University |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 519 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Blowout, Alabama, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Alabama | |||||||
| Coordinates | Lat. (o) | 30.15 | Long. (o) | -88.446 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006294 | Metagenome / Metatranscriptome | 377 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2222406594 | F006294 | N/A | MMTDSDKPKDNIILFPKMPRKPMTQKAQELDAKRQEMIRLEHNKIFVQAVSEDLTEAMLMRLKDEGVNLVDPIFLKDYKLLSEALKSLILRHVHMKHPLQERV |
| ⦗Top⦘ |