Scaffold 2221194516

Overview

Basic Information

• Taxon OID: 2209111022
• Scaffold ID: 2221194516
• Source Dataset Name: Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1599
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location

• Location Name: Rothamsted, Harpenden, UK
• Coordinates
  • Lat. (^o): 51.481481
  • Long. (^o): 0.222231

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004481	Metagenome / Metatranscriptome	436	Y

Sequences

Protein ID	Family	RBS	Sequence
2222013910	F004481	N/A	WICDCCILRVFECASAFAKPQKKPAGSGQENADPLVNAAMKNMETGVWSVKGTVTAKKPIKLQGLLSGEDFDLTMEPGVNPNTPMREIVIKNKAWICSDGETWHATRPDDRLIYNWVHVPIMADRKLPPFEKVGSEQRNGQTLLHVRLKVPEKNINPKELPQYWLVLDSQGQAQYVGHTEMPMYSQARKEVMYCSFDYAPAEKRSSRHHSGHQLMTRRMV