Scaffold Meso_c745299

Overview

Basic Information

• Taxon OID: 2209111018
• Scaffold ID: Meso_c745299
• Source Dataset Name: Mesophilic bioreactor microbial communities at Bielefeld, Germany
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: West Virginia State University
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 529
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor → Microbial Communities From Bioreactor At West Virginia State University,Usa And At Bielefeld, Germany

Source Dataset Sampling Location

• Location Name: Germany: Werther, Bielefeld
• Coordinates
  • Lat. (^o): 52.09722606
  • Long. (^o): 8.43561172

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096294	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Meso_7452992	F096294	AGGAGG	VNKEIPGKIGEYDDNLIVEISNSVESLKTKYYRLITKEQYEAELKKAYFSGWEDRNDCELREIIHKRKATKEDYFKWFMEEKEKR