| Basic Information | |
|---|---|
| Taxon OID | 2209111016 Open in IMG/M |
| Scaffold ID | draft_c328622 Open in IMG/M |
| Source Dataset Name | Thermophilic bioreactor microbial communities at WVSU, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | West Virginia State University |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 515 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor → Microbial Communities From Bioreactor At West Virginia State University,Usa And At Bielefeld, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062734 | Metagenome / Metatranscriptome | 130 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| draft_3286221 | F062734 | N/A | ITGEPSGDQIRWVISDGEPPYTVFVNGVEIVTDYPGTVILTDSEPGKQYTAVVMDNESVADATVIGEYYTYPLWAWLLFAALLACLVVSIWLPYAAFGAAIAGGFLLLLIAPNPDYAPYLRIFAGAAFIVGLWRTCREVAVVKTIKTIKIQILRTGRELTKQSITGTLWQN |
| ⦗Top⦘ |