NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2217229512

Scaffold 2217229512


Overview

Basic Information
Taxon OID2209111009 Open in IMG/M
Scaffold ID2217229512 Open in IMG/M
Source Dataset NameSaline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS19
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)547
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Source Dataset Sampling Location
Location NameSpain: Bras del Port
CoordinatesLat. (o)38.11Long. (o)-0.36Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056035Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
2217176065F056035N/AMWRLIKTKMSLLYKSKEEQTTTCEIKQEGGKIVLDFYSDCGKFGTDEMLDGYKLTPERLLQILQDRDDYSEDELYP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.