| Basic Information | |
|---|---|
| Taxon OID | 2209111009 Open in IMG/M |
| Scaffold ID | 2216706084 Open in IMG/M |
| Source Dataset Name | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS19 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 518 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: Bras del Port | |||||||
| Coordinates | Lat. (o) | 38.11 | Long. (o) | -0.36 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097996 | Metagenome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2216696870 | F097996 | N/A | NSLIFIMEKYYGYYQRWYASRYLGFQRAEPVFVKIPFVSDGKNWKKSEHFNWAERDIEEQDAASLYATGHIYHNTELAKANKVGDRLGELNKEQLYRLVVQLNGIVKDKTTTTQEFNDKRCKQSKIEDKQRGLIRRFLNRNPWIVEDFYQLRDHILGND |
| ⦗Top⦘ |