| Basic Information | |
|---|---|
| Taxon OID | 2209111004 Open in IMG/M |
| Scaffold ID | 2212209670 Open in IMG/M |
| Source Dataset Name | Macrotermes natalensis queen gut microbiome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1174 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Macrotermes Natalensis Queen Gut → Macrotermes Natalensis Queen Gut Microbial Communities From Naboomspruit, South Africa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Africa: Naboomspruit | |||||||
| Coordinates | Lat. (o) | -24.5160467 | Long. (o) | 28.699288 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049726 | Metagenome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2212241848 | F049726 | N/A | MIDWKFLVNLLKPTGHVMHQQFNIQQLYVLPTLYLCVLYLSENKQRLVPLTA |
| ⦗Top⦘ |