Basic Information | |
---|---|
Taxon OID | 2209111004 Open in IMG/M |
Scaffold ID | 2212178505 Open in IMG/M |
Source Dataset Name | Macrotermes natalensis queen gut microbiome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 570 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Macrotermes Natalensis Queen Gut → Macrotermes Natalensis Queen Gut Microbial Communities From Naboomspruit, South Africa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Africa: Naboomspruit | |||||||
Coordinates | Lat. (o) | -24.5160467 | Long. (o) | 28.699288 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063059 | Metagenome | 130 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2212205007 | F063059 | N/A | ITVLKAKEIHTQTRNRERSDFEGGIFDTETPRKTAQTLANELVSVLYPCHSDVQLYRPTSVVKTAAITIDMIRTNYSSTDSILKILLHLGYFTEHGTYQRTIMIL |
⦗Top⦘ |