Scaffold 2211884910

Overview

Basic Information

• Taxon OID: 2209111004
• Scaffold ID: 2211884910
• Source Dataset Name: Macrotermes natalensis queen gut microbiome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1821
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Macrotermes Natalensis Queen Gut → Macrotermes Natalensis Queen Gut Microbial Communities From Naboomspruit, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Naboomspruit
• Coordinates
  • Lat. (^o): -24.5160467
  • Long. (^o): 28.699288
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009216	Metagenome	321	Y

Sequences

Protein ID	Family	RBS	Sequence
2211917501	F009216	GGA	MLIRSLGKPKNIWEDDIRKDMEEMKVKNWISCIQDRNNWKLCVEKAKTFNN