| Basic Information | |
|---|---|
| Taxon OID | 2209111000 Open in IMG/M |
| Scaffold ID | 2209720765 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Colorado Plateau, Greene Butte sample - Dark Crust, Colorado Plateau, Green Butte |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 536 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Moab, Utah | |||||||
| Coordinates | Lat. (o) | 38.714972 | Long. (o) | -109.692944 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023050 | Metagenome | 211 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2209866709 | F023050 | AGG | VDAKPPETGHAGGPGELRLVDGSNYYYDPLETSKELFLHAYDLQLGHGEKWPEPPEIYRKMCEARDPAAVLERLKPESPQGAFVDPTTLYDTDALIRERRLVPISVEPVEDLSE |
| ⦗Top⦘ |