Basic Information | |
---|---|
Taxon OID | 2209111000 Open in IMG/M |
Scaffold ID | 2209333254 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Colorado Plateau, Greene Butte sample - Dark Crust, Colorado Plateau, Green Butte |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1709 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Moab, Utah | |||||||
Coordinates | Lat. (o) | 38.714972 | Long. (o) | -109.692944 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042091 | Metagenome / Metatranscriptome | 159 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2209409865 | F042091 | GGAG | MTFSDGCPGGRSQLFTFKAKETITVDRPTLEHIFALLNGCSTNFKYLCDNDIFVFATKNYLASLDNPESGKALNLLGVWTDTWPDASEELADGLDEAVQSIKFILAVTA |
⦗Top⦘ |