| Basic Information | |
|---|---|
| Taxon OID | 2199352025 Open in IMG/M |
| Scaffold ID | deepsgr__Contig_106952 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Argonne National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1204 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rothamsted, Uk, For Project Deep Soil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | United Kingdom Rothamsted | |||||||
| Coordinates | Lat. (o) | 56.03 | Long. (o) | -2.82 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077590 | Metagenome / Metatranscriptome | 117 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| deepsgr_01664840 | F077590 | AGGAGG | MASRPKHVRGILTVALCAIVVLPFILWLSTLFGPAIWVLAGLMTIAIVALVWRRRAVEAARERAYEGSSLRAVVVRMRAREAAQTLALEERRFELLGAR |
| ⦗Top⦘ |