| Basic Information | |
|---|---|
| Taxon OID | 2199352024 Open in IMG/M |
| Scaffold ID | deeps_contig19362.12662 Open in IMG/M |
| Source Dataset Name | Bare-fallow DEEP SOIL |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Argonne National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5222 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rothamsted, Uk, For Project Deep Soil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | United Kingdom Rothamsted | |||||||
| Coordinates | Lat. (o) | 56.03 | Long. (o) | -2.82 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017355 | Metagenome / Metatranscriptome | 241 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| deeps_02295860 | F017355 | AGGAGG | MVKKVFTLLFASVLVFGSSALMFAQEGSKPAEGMAAEKARAEGIVVRSNKDNSTLTVRNRDTNVEKTVHYDSTTQWTAQEHHSKKMNDIDASAVKDGDRVICVGTWDKDGSLHAASISKRLTN |
| ⦗Top⦘ |