Scaffold deeps__Contig_64929

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold deeps__Contig_64929

Scaffold deeps__Contig_64929

Overview

Basic Information
Taxon OID	2199352024 Open in IMG/M
Scaffold ID	deeps__Contig_64929 Open in IMG/M
Source Dataset Name	Bare-fallow DEEP SOIL
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Argonne National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1868
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rothamsted, Uk, For Project Deep Soil

Source Dataset Sampling Location
Location Name	United Kingdom Rothamsted
Coordinates	Lat. (^o)	56.03	Long. (^o)	-2.82	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016413	Metagenome / Metatranscriptome	247	Y

Sequences

Protein ID	Family	RBS	Sequence
deeps_00996210	F016413	GAG	METIILSQRHAAFLSRVSGEINPAMPPAFGWPHAIRLILERIEESGVDLTQAASEGEIASLAAVGLRARSRRRTADR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.