| Basic Information | |
|---|---|
| Taxon OID | 2199352018 Open in IMG/M |
| Scaffold ID | QLA_contig22664.22664 Open in IMG/M |
| Source Dataset Name | Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 680 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Qinghai Lake, Tibetan Plateau | |||||||
| Coordinates | Lat. (o) | 36.381 | Long. (o) | 100.218 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056178 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| QLA_00671570 | F056178 | GGA | LSSWHYQIMRHTADSGEDYLGVHEFYTMHDGKLGWTAKPVPIEADTLPEMRRALIDILRDLERHGVRDARTGEVVD |
| ⦗Top⦘ |