NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2200859692

Scaffold 2200859692


Overview

Basic Information
Taxon OID2199352012 Open in IMG/M
Scaffold ID2200859692 Open in IMG/M
Source Dataset NameMesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28383
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (28.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley

Source Dataset Sampling Location
Location NameDavis, California, USA
CoordinatesLat. (o)38.5402727Long. (o)-121.7500776Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099155Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
2201540165F099155N/AMKSLERLVVTPEHFPLEITVSTGEKYLLPHPDHVQMHPNTRDLAIYPDEGPFSLVINPAQVVSVKPVRKAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.