| Basic Information | |
|---|---|
| Taxon OID | 2199352009 Open in IMG/M |
| Scaffold ID | 2200354428 Open in IMG/M |
| Source Dataset Name | Marine subseafloor sediment microbial communities, sample from White Oak River Estuary, NC, USA 14E |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 613 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Peru Margin, Gulf Of Mexico And South Pacific Gyre |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Oak River Estuary, North Carolina, subseafloor sediments from , Sample 14E; 24 centimeters below seafloor | |||||||
| Coordinates | Lat. (o) | 34.690251 | Long. (o) | -77.106571 | Alt. (m) | Depth (m) | .24 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030967 | Metagenome | 183 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2200753299 | F030967 | GAGG | VNVEELKRLEEFEKRLNKLEAHGFEDTLTLVEILSSITFFGGLKMEKCKYAKEGQCGFFFLKNEAKKKIPMASDCRIKDCTGEPDHCHLELSNVTCAFCPKARIP |
| ⦗Top⦘ |