| Basic Information | |
|---|---|
| Taxon OID | 2199352008 Open in IMG/M |
| Scaffold ID | 2200140286 Open in IMG/M |
| Source Dataset Name | Thermophilic microbial communities from the Joint Bioenergy Institute, California, USA of rice/straw/compost enrichment - eDNA_2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 630 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Davis, California, USA | |||||||
| Coordinates | Lat. (o) | 38.5402727 | Long. (o) | -121.7500776 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001564 | Metagenome / Metatranscriptome | 670 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2200444765 | F001564 | N/A | LCDPALCPDAPEGGRCDHCPLDRLDAAQSSEPGQLLRRALDLRAAFKLGVKLSLDEIAADEFQAMLIVEEEQARFDEERLNRHG |
| ⦗Top⦘ |