Scaffold 2199993423

Overview

Basic Information

• Taxon OID: 2199352005
• Scaffold ID: 2199993423
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 900
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. tf2-5 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, WI
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103115	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
2200207154	F103115	AGAAG	MFKYLDAMYPELYILELDFLGDIVQTFDEERQSDWLDNRRVGRGKGSWFDQRKEIIEGLTLMFCVTEVTADIILNEWVWSRPKYKYVRESVDKQVLVP