Scaffold GS313G0146KB_1112118315080

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GS313G0146KB_1112118315080

Scaffold GS313G0146KB_1112118315080

Overview

Basic Information
Taxon OID	2189573028 Open in IMG/M
Scaffold ID	GS313G0146KB_1112118315080 Open in IMG/M
Source Dataset Name	Estuarine microbial communities from Columbia River, sample from South Channel ETM site, CMGS313-FOS-0p8-ETM-15m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of South Carolina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	930
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Columbia River estuary, South channel near Astoria
Coordinates	Lat. (^o)	46.249	Long. (^o)	-123.986	Alt. (m)		Depth (m)	15
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052252	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
GS313G0146KB_00090420	F052252	N/A	MNQNEFVNPQQIRSPYTGETSRPTYNTYDADGKTYEQAVFSDPVTGHIIKKGLVSVKDAQTGELIADYNGIIKSVTTQSRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.