Basic Information | |
---|---|
Taxon OID | 2189573027 Open in IMG/M |
Scaffold ID | GS312G0146KB_1114696588577 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of South Carolina |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 506 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River Transect 7 km from mouth (CR7) | |||||||
Coordinates | Lat. (o) | 46.167 | Long. (o) | -124.158 | Alt. (m) | Depth (m) | 15 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004192 | Metagenome / Metatranscriptome | 449 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GS312G0146KB_00263500 | F004192 | N/A | MKLDFNEWMASIKNIYYADNEKMLNAFEKLEEDEEV |
⦗Top⦘ |