NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GS312G0146KB_1113212477912

Scaffold GS312G0146KB_1113212477912


Overview

Basic Information
Taxon OID2189573027 Open in IMG/M
Scaffold IDGS312G0146KB_1113212477912 Open in IMG/M
Source Dataset NameEstuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of South Carolina
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)798
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameColumbia River Transect 7 km from mouth (CR7)
CoordinatesLat. (o)46.167Long. (o)-124.158Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010877Metagenome / Metatranscriptome298Y

Sequences

Protein IDFamilyRBSSequence
GS312G0146KB_00148560F010877N/AMTQKELMLALAGGGLPKNDIKKEMFSFYNSMVGKSKYFSKQENPKTACGSCIQRVKTSIWKWYHSDETAPTYSELEFMGRLGAHNIPLYKVVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.