Scaffold GS312G0146KB_1113212387265

Overview

Basic Information

• Taxon OID: 2189573027
• Scaffold ID: GS312G0146KB_1113212387265
• Source Dataset Name: Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 893
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Columbia River Transect 7 km from mouth (CR7)
• Coordinates
  • Lat. (^o): 46.167
  • Long. (^o): -124.158
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055426	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
GS312G0146KB_00086270	F055426	N/A	NLVIDKPAPITVKLAQIEKDDKMKNLVNATTNATSLAQGVPVHVSPVLMKDTMGDAKLDMHILVGPDEVELKKKQAAAAKQQALGQKEGTPVYVNPVLMSNSMGDANLGMKMRVGPDEVQVEKKNAQKKEGTKLAQTTNPVWNPPFNNWSVNQPSGPHQTGLSAYQDLGQNMIVDGHRVH