NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GS310G0146KB_1113212415041

Scaffold GS310G0146KB_1113212415041


Overview

Basic Information
Taxon OID2189573025 Open in IMG/M
Scaffold IDGS310G0146KB_1113212415041 Open in IMG/M
Source Dataset NameMarine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-FOS-0p8-Hyp-75m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of South Carolina
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)858
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameNewport Hydroline 10 km (NH10)
CoordinatesLat. (o)44.651Long. (o)-124.295Alt. (m)Depth (m)75
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097387Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
GS310G0146KB_00134160F097387N/AMKQIVLFLIIMVLMGFTISANQKENSWEVKYHEVKKERDYYKKTSEQLLKNWKDCEEKLVEVI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.