NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GZGWRS401CDZK3

Scaffold GZGWRS401CDZK3


Overview

Basic Information
Taxon OID2189573004 Open in IMG/M
Scaffold IDGZGWRS401CDZK3 Open in IMG/M
Source Dataset NameGrass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)510
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location NameRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)Depth (m)0 to .21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047276Metagenome150Y

Sequences

Protein IDFamilyRBSSequence
FG2_07992470F047276N/AGLLRTAARLLPPGSREWTEAVTAESGQVPAGWPRLGWLAGGLWLAVREAKMMRKVVYWLGVGMVAATAAWAVRLSWHASPHAHPLVVTDRVRVLVGVAALAGLPWVGRRRGWFGPVGTSITARLVRVAGCAALCGLGMAVVRMDRDVGGGPHGATPFSLPREIVAVVLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.