Scaffold GZR05M101CVAMH

Overview

Basic Information

• Taxon OID: 2189573001
• Scaffold ID: GZR05M101CVAMH
• Source Dataset Name: Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location

• Location Name: Rothamsted, Harpenden, UK
• Coordinates
  • Lat. (^o): 51.804241
  • Long. (^o): -0.372114
  • Depth (m): 0 to .21

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075163	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
FD2_01413220	F075163	N/A	PGATAWAVPAERVQSEQPAGTPYKHQSNWEPTVATDPGHPDLVYQLITGINAHQCAPRCPGTSVLFRKSTNGGSTWGAEQFVCGLAXKGVGWQFDPQIKVATDTNQSCGCGTIYVVFLNTFDPGAVLFKSHDGGASWQGPITMNGSLTYMDKPVLVISPAGKDVYVAFNGKLS