| Basic Information | |
|---|---|
| Taxon OID | 2170459024 Open in IMG/M |
| Scaffold ID | GZRSKLJ02I3EDS Open in IMG/M |
| Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 512 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rothamsted, Harpenden, UK | |||||||
| Coordinates | Lat. (o) | 51.804241 | Long. (o) | -0.372114 | Alt. (m) | Depth (m) | 0 to .21 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042045 | Metagenome / Metatranscriptome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FD1_05532160 | F042045 | N/A | GISIIDISKPAEPKALGVIPWPDPAMSSRMNVTGDLAIIAETGALPMPSSTSNGDLVLWDLSNPVAPRVVRKFSGVVKWIQDERNFIYVLNGDGLWVVSK |
| ⦗Top⦘ |