Scaffold GZGNO2B02HP3VF

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GZGNO2B02HP3VF

Scaffold GZGNO2B02HP3VF

Overview

Basic Information
Taxon OID	2170459023 Open in IMG/M
Scaffold ID	GZGNO2B02HP3VF Open in IMG/M
Source Dataset Name	Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	512
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location Name	USA: Maryland: Natonal Institute of Health
Coordinates	Lat. (^o)	39.0042816	Long. (^o)	-77.1012173	Alt. (m)		Depth (m)	0 to .21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024659	Metagenome / Metatranscriptome	205	N

Sequences

Protein ID	Family	RBS	Sequence
FA3_00447870	F024659	N/A	LVVIGIGSIAAAVLLNPLRRSETDIRGWLLHQAPLGSSRQEVMVLVARRGWKFHPEYRGRFINKSVPVGGFGAELGTYLGVRDVKVDAYWKFSGSDNLDEVYVNKWNEGF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.