Scaffold G14TP7Y02JDNT5

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold G14TP7Y02JDNT5

Scaffold G14TP7Y02JDNT5

Overview

Basic Information
Taxon OID	2170459021 Open in IMG/M
Scaffold ID	G14TP7Y02JDNT5 Open in IMG/M
Source Dataset Name	Litter degradation NP4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	590
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location
Location Name	University of Illinois Energy Farm
Coordinates	Lat. (^o)	40.1097	Long. (^o)	-88.2041	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048456	Metagenome	148	N

Sequences

Protein ID	Family	RBS	Sequence
4NP_01380370	F048456	N/A	MFWYVSSKQSTDTRDGRSLYTAFRRILHAIHVAEAEDTIIIVPGIYDQDLAKRIGEDRSAGMSVTVAGSEIST

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.