Scaffold G14TP7Y02IKGPB

Overview

Basic Information

• Taxon OID: 2170459019
• Scaffold ID: G14TP7Y02IKGPB
• Source Dataset Name: Litter degradation MG4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 647
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location

• Location Name: University of Illinois Energy Farm
• Coordinates
  • Lat. (^o): 40.1097
  • Long. (^o): -88.2041

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004391	Metagenome / Metatranscriptome	440	Y

Sequences

Protein ID	Family	RBS	Sequence
4MG_03626070	F004391	GGAG	LLYEDETVLWRFALPRAGWWRKTPRVRLPIRPLSQSQIKQEESRKRQTWGQYRSWSRITSGVLLSVIGAVQYGTSKVFSKIVPHFDAQELRQYLHQVMATSAKPANDVVMVVDRSGSHRAHKLDTTFAHY