Scaffold G14TP7Y01AUN5T

Overview

Basic Information

• Taxon OID: 2170459019
• Scaffold ID: G14TP7Y01AUN5T
• Source Dataset Name: Litter degradation MG4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location

• Location Name: University of Illinois Energy Farm
• Coordinates
  • Lat. (^o): 40.1097
  • Long. (^o): -88.2041

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071767	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
4MG_04086100	F071767	AGCAG	MRTADREISHHETLLKIQRRNLRALELQIAQHGPFDVPLHMRGAQDDLRAEVVRLDRALRDLRMRLRRLKSKR