Scaffold G1P06HT01CFYSM

Overview

Basic Information

• Taxon OID: 2170459016
• Scaffold ID: G1P06HT01CFYSM
• Source Dataset Name: Litter degradation ZMR2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 761
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter → Switchgrass, Maize And Mischanthus Litter Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location

• Location Name: University of Illinois Energy Farm
• Coordinates
  • Lat. (^o): 40.1097
  • Long. (^o): -88.2041

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025939	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
2ZMR_01934400	F025939	GAG	VSGLLQAFFYDPNPTFGASPTPFIVLMIMGFVIGVIGHIVRAKGLVALGIGMVFLATFLLPLVTNVLKSQQ