NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GA8OVOZ01A05SS

Scaffold GA8OVOZ01A05SS


Overview

Basic Information
Taxon OID2170459008 Open in IMG/M
Scaffold IDGA8OVOZ01A05SS Open in IMG/M
Source Dataset NameGrass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location NameRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)Depth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005962Metagenome / Metatranscriptome385Y

Sequences

Protein IDFamilyRBSSequence
F48_08676270F005962N/AMVMETIRDNGHSDRVVKKCQRIAGMKALLKEWELSSNLDLDYIRGLKARLLSVQNQLKNMCGHDGSEGMEDW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.