Scaffold GBPF9FW02GR832

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GBPF9FW02GR832

Scaffold GBPF9FW02GR832

Overview

Basic Information
Taxon OID	2170459006 Open in IMG/M
Scaffold ID	GBPF9FW02GR832 Open in IMG/M
Source Dataset Name	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	505
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Source Dataset Sampling Location
Location Name	Rothamsted, Harpenden, UK
Coordinates	Lat. (^o)	51.804241	Long. (^o)	-0.372114	Alt. (m)		Depth (m)	0 to .1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056195	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
L01_05242760	F056195	GGA	MPPVTDIAVYQKLTEIADELDQMVSEGPSLVGDAALGTAARTVRGMASAVYQHIMST

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.