| Basic Information | |
|---|---|
| Taxon OID | 2170459002 Open in IMG/M |
| Scaffold ID | FZY7DQ102GQSXC Open in IMG/M |
| Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 538 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rothamsted, Harpenden, UK | |||||||
| Coordinates | Lat. (o) | 51.804241 | Long. (o) | -0.372114 | Alt. (m) | Depth (m) | 0 to .21 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003992 | Metagenome / Metatranscriptome | 458 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| E1_02999980 | F003992 | GAGG | MFEQPVNLPTVLYLGVFSRAEQRVLQAIFKAIAEGNGRCVATLARLARDSNTSKSTTRNAVTQAVAIGLLKKTERRSQCAISLPNILTFGE |
| ⦗Top⦘ |