Scaffold LBLPB2_contig00640

Overview

Basic Information

• Taxon OID: 2166559021
• Scaffold ID: LBLPB2_contig00640
• Source Dataset Name: Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from peak-bloom 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 729
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: LaBonte Lake, Laramie, Wyoming
• Coordinates
  • Lat. (^o): 41.321
  • Long. (^o): -105.586

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055533	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
LBLPB2_02864940	F055533	AGGA	MATQNEIKNAILKAAGNPTVGVIADIADDLAKAVWELDNTNSYNPAKEARVVDIKETR