Scaffold stn_contig21026

Overview

Basic Information

• Taxon OID: 2166559019
• Scaffold ID: stn_contig21026
• Source Dataset Name: Stentor MTG 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Leibniz Institute
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 540
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Postciliodesmatophora → Heterotrichea → Heterotrichida → Stentoridae → Stentor → Stentor coeruleus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus → Stentor Amethystinus Microbial Communities From Lake Stechlin, Germany

Source Dataset Sampling Location

• Location Name: Lake Stechlin Germany
• Coordinates
  • Lat. (^o): 53.144075
  • Long. (^o): 13.02274
  • Depth (m): 68

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051728	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
stn_00105190	F051728	N/A	RKPKAAFDKWKKYLERLKHKDFFDGLRSAKLLNVLTRIPLRTTRDTTQRILGGGDIIKGALNNVINGLKNIPKKALRNWAKAVQDIKEKKLFDNARSAKLLNSLEKIPKRTLKEAAERLKGIIFASPQVKASIKNIDNILKRKPKEAYDKWKKYVTAVNNKELLDNIKSQKLQTALNRV