| Basic Information | |
|---|---|
| Taxon OID | 2166559019 Open in IMG/M |
| Scaffold ID | stn_contig01971 Open in IMG/M |
| Source Dataset Name | Stentor MTG 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Leibniz Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 728 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus → Stentor Amethystinus Microbial Communities From Lake Stechlin, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Stechlin Germany | |||||||
| Coordinates | Lat. (o) | 53.144075 | Long. (o) | 13.02274 | Alt. (m) | Depth (m) | 68 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003690 | Metagenome / Metatranscriptome | 473 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| stn_00427060 | F003690 | GGA | MIPSGFELSITNEYGFELDSFLGAIYLPWHTIAIATALLIAYKIYKRKKNK |
| ⦗Top⦘ |