| Basic Information | |
|---|---|
| Taxon OID | 2166559019 Open in IMG/M |
| Scaffold ID | stn_contig00782 Open in IMG/M |
| Source Dataset Name | Stentor MTG 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Leibniz Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 545 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus → Stentor Amethystinus Microbial Communities From Lake Stechlin, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Stechlin Germany | |||||||
| Coordinates | Lat. (o) | 53.144075 | Long. (o) | 13.02274 | Alt. (m) | Depth (m) | 68 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012001 | Metagenome / Metatranscriptome | 284 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| stn_00338250 | F012001 | AGGA | MNQEKIKQIALTYLRSAASVAVGLYMTGVHDPKVLASAFVAGLVGPVLKALDPSAKEFGITKK |
| ⦗Top⦘ |